Scaffold none_p071040

Overview

Basic Information

• Taxon OID: 2236876005
• Scaffold ID: none_p071040
• Source Dataset Name: Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 573
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Columbia River estuary, South channel near Astoria
• Coordinates
  • Lat. (^o): 46.249
  • Long. (^o): -123.986
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086365	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
none_0710401	F086365	N/A	MKFTKNELNLMRYAMEDLLNGDDVPNDKDKFETHVNEIIEKIDLNLTSVVDR