Scaffold none_p085033

Overview

Basic Information

• Taxon OID: 2236876003
• Scaffold ID: none_p085033
• Source Dataset Name: Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p8-ETM-15m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 507
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Columbia River estuary, South channel near Astoria
• Coordinates
  • Lat. (^o): 46.249
  • Long. (^o): -123.986
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066524	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
none_0850331	F066524	AGG	MATLGSLNYAQLVTAVTDYTQNTFDTTDMNTMIQQAEQRIYNTV