Scaffold ICCgaii200_c0601733

Overview

Basic Information

• Taxon OID: 2228664021
• Scaffold ID: ICCgaii200_c0601733
• Source Dataset Name: Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 806
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Depth (m): .1016

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015535	Metagenome / Metatranscriptome	254	Y

Sequences

Protein ID	Family	RBS	Sequence
ICCgaii200_06017332	F015535	GGAG	MLEEVTKFIEAYRGSGSHGPDVIAEFYSEPCVMAGRGVVRVNPARHDTELLLVEAEAEYRARGFTHRDILNMNVQALGSXXALATVQWAYKGACEEMLWKTTFSYNLYRRDGVWKILVQTMHDS