Scaffold 2226231951

Overview

Basic Information

• Taxon OID: 2225789001
• Scaffold ID: 2226231951
• Source Dataset Name: Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11638
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake

Source Dataset Sampling Location

• Location Name: Qinghai Lake, Tibetan Plateau
• Coordinates
  • Lat. (^o): 36.381
  • Long. (^o): 100.218
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020114	Metagenome / Metatranscriptome	226	Y

Sequences

Protein ID	Family	RBS	Sequence
2226362985	F020114	N/A	LETKNDYETTKNSKHISRCVDTHGVHHLDALDDYGRHWYATMEQKEEPWLTYTQQWHL