NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2225744667

Scaffold 2225744667


Overview

Basic Information
Taxon OID2222084010 Open in IMG/M
Scaffold ID2225744667 Open in IMG/M
Source Dataset NameCoastal lagoon microbial communities from Mar Menor, Spain - Sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity Miguel Hernandez
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4025
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain

Source Dataset Sampling Location
Location NameMar Menor, Spain
CoordinatesLat. (o)37.72955Long. (o)-0.7741Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007506Metagenome / Metatranscriptome350Y
F011808Metagenome / Metatranscriptome287Y

Sequences

Protein IDFamilyRBSSequence
2225138931F007506AGGMIAARFHHVFGLSIETVQSQPVLGWKQEEEIGDAQVYFFDGFVINIPFVKIMIGDVFDVF
2225138934F011808AGGAGGVDSTQILSRLELVKDIDPFNKKLMNDTYDHIKGLQEEVKRLQYHNNNLMNVIYQNQGELENT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.