Scaffold 2225734752

Overview

Basic Information

• Taxon OID: 2222084010
• Scaffold ID: 2225734752
• Source Dataset Name: Coastal lagoon microbial communities from Mar Menor, Spain - Sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University Miguel Hernandez
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1848
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain

Source Dataset Sampling Location

• Location Name: Mar Menor, Spain
• Coordinates
  • Lat. (^o): 37.72955
  • Long. (^o): -0.7741
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000302	Metagenome / Metatranscriptome	1337	Y

Sequences

Protein ID	Family	RBS	Sequence
2225116490	F000302	AGGAGG	MVXTMTQDTKDRIAELERQKIELNDQLEILGYTGNLVKMHQIEEQIFEIEDTIKKLTA