Scaffold Meso_c428880

Overview

Basic Information

• Taxon OID: 2209111018
• Scaffold ID: Meso_c428880
• Source Dataset Name: Mesophilic bioreactor microbial communities at Bielefeld, Germany
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: West Virginia State University
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 601
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor → Microbial Communities From Bioreactor At West Virginia State University,Usa And At Bielefeld, Germany

Source Dataset Sampling Location

• Location Name: Germany: Werther, Bielefeld
• Coordinates
  • Lat. (^o): 52.09722606
  • Long. (^o): 8.43561172

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095115	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Meso_4288801	F095115	N/A	IYGGLKEVKVMIRTMKKALKYAMSKSENPAKVKEYMEEYFDTIGGDRRYKFKWKALSGNSKYTFSGIFEYRGKVYYFHKIGGELELEYHNR