Basic Information | |
---|---|
Taxon OID | 2209111016 Open in IMG/M |
Scaffold ID | draft_c720447 Open in IMG/M |
Source Dataset Name | Thermophilic bioreactor microbial communities at WVSU, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | West Virginia State University |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 504 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor → Microbial Communities From Bioreactor At West Virginia State University,Usa And At Bielefeld, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072355 | Metagenome / Metatranscriptome | 121 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_7204471 | F072355 | N/A | NLVFRLDMAKYHFDENGVTDLQSIIFGVAGAVVALIVAVIVLGNLDTATRGTVNESSAYYTLLDTVNQYGSTAFVLLAIGVIVAGAAAILYIIRGSF |
⦗Top⦘ |