NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold draft_c151465

Scaffold draft_c151465


Overview

Basic Information
Taxon OID2209111016 Open in IMG/M
Scaffold IDdraft_c151465 Open in IMG/M
Source Dataset NameThermophilic bioreactor microbial communities at WVSU, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterWest Virginia State University
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)524
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor → Microbial Communities From Bioreactor At West Virginia State University,Usa And At Bielefeld, Germany

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074887Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
draft_1514651F074887N/AMVHYEVVWPGGDLLGIFPSYAAALERARVWWERGYACRIRKRVPCLAPSALTMAAAVRKLRRESML
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.