Scaffold draft_c1059509

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold draft_c1059509

Scaffold draft_c1059509

Overview

Basic Information
Taxon OID	2209111016 Open in IMG/M
Scaffold ID	draft_c1059509 Open in IMG/M
Source Dataset Name	Thermophilic bioreactor microbial communities at WVSU, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	West Virginia State University
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	539
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor → Microbial Communities From Bioreactor At West Virginia State University,Usa And At Bielefeld, Germany

Source Dataset Sampling Location
Location Name	USA: Maryland: Natonal Institute of Health
Coordinates	Lat. (^o)	39.0042816	Long. (^o)	-77.1012173	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062734	Metagenome / Metatranscriptome	130	N

Sequences

Protein ID	Family	RBS	Sequence
draft_10595092	F062734	N/A	GTTITGEPSGDQIRWVISDGEPPYTVFVNGVEIVTDYPGTVILTDSEPGKQYTAVVMDNESVADATVIGEYYTYPLWAWLLFAALLACLVVSIWLPYAAFGAAIAGGFLLLLIAPNPDYAPYLRIFAGAAFIVGLGGLAGRLQS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.