NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold le_contig00389.2750

Scaffold le_contig00389.2750


Overview

Basic Information
Taxon OID2209111012 Open in IMG/M
Scaffold IDle_contig00389.2750 Open in IMG/M
Source Dataset Name2000 evening metatranscriptome
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterLeibniz Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)577
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From Grosse Fuchskuhle, Germany, For Comparative Metatranscriptomics

Source Dataset Sampling Location
Location NameGermany: Grosse Fuchskuhle
CoordinatesLat. (o)53.1058Long. (o)12.9847Alt. (m)Depth (m).5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092248Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
le_00164460F092248N/ALRLLLPLSDKVYLTFHASLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.