Basic Information | |
---|---|
Taxon OID | 2209111012 Open in IMG/M |
Scaffold ID | le_contig00389.2750 Open in IMG/M |
Source Dataset Name | 2000 evening metatranscriptome |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Leibniz Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 577 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From Grosse Fuchskuhle, Germany, For Comparative Metatranscriptomics |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany: Grosse Fuchskuhle | |||||||
Coordinates | Lat. (o) | 53.1058 | Long. (o) | 12.9847 | Alt. (m) | Depth (m) | .5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092248 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
le_00164460 | F092248 | N/A | LRLLLPLSDKVYLTFHASLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY |
⦗Top⦘ |