NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2214928823

Scaffold 2214928823


Overview

Basic Information
Taxon OID2209111006 Open in IMG/M
Scaffold ID2214928823 Open in IMG/M
Source Dataset NameArabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)544
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location NameUniversity of North Carolina
CoordinatesLat. (o)35.9Long. (o)-79.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000336Metagenome / Metatranscriptome1274Y
F003318Metagenome / Metatranscriptome494Y

Sequences

Protein IDFamilyRBSSequence
2213990379F003318N/APGKKFNATAFNAKVNEGNAKFQQAIADEKFTARRPVLVNLKGQFDADAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR
2213990380F000336N/AMPSAGKPKRKKHKKSELDSALGQISDESIAATKDEFQDLLSQAKGDTSELVRQNAEELERRLVLLKKRKIDKEDFDFFVENQKRDLRVFIDSQPAQQQERAEKL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.