Scaffold 2211861394

Overview

Basic Information

• Taxon OID: 2209111004
• Scaffold ID: 2211861394
• Source Dataset Name: Macrotermes natalensis queen gut microbiome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1914
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Macrotermes Natalensis Queen Gut → Macrotermes Natalensis Queen Gut Microbial Communities From Naboomspruit, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Naboomspruit
• Coordinates
  • Lat. (^o): -24.5160467
  • Long. (^o): 28.699288
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000062	Metagenome	2853	Y

Sequences

Protein ID	Family	RBS	Sequence
2211895090	F000062	N/A	MWNVKAKMIPVIIEAIGTTSTSFTQYLNNIPGKYEIKELQKKRSILGTAHILQKVLM