Scaffold 2206378124

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2206378124

Scaffold 2206378124

Overview

Basic Information
Taxon OID	2199352032 Open in IMG/M
Scaffold ID	2206378124 Open in IMG/M
Source Dataset Name	Cave microbial community (Speleothem A)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Arizona Genomics Institute
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	502
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces → Speleothem And Rock Wall Surfaces Microbial Communities From Kartchner Caverns, Benson, Arizona, Usa

Source Dataset Sampling Location
Location Name	USA: Arizona
Coordinates	Lat. (^o)	31.837801	Long. (^o)	-110.350292	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020970	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
2208076460	F020970	N/A	IGDTNERANGTAVLKIEYSDGKAGVLTVGCHGPGAPPGIFEGIAVTKGFTTYYAVQPPAAGVDANRTLFHVRR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.