Scaffold deepsgr__Contig_64125

Overview

Basic Information

• Taxon OID: 2199352025
• Scaffold ID: deepsgr__Contig_64125
• Source Dataset Name: Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Argonne National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 933
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rothamsted, Uk, For Project Deep Soil

Source Dataset Sampling Location

• Location Name: United Kingdom Rothamsted
• Coordinates
  • Lat. (^o): 56.03
  • Long. (^o): -2.82

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026444	Metagenome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
deepsgr_00826330	F026444	N/A	MAKLFIALMVTREGQAVLEKNDMRSSYLVDGTLMSKYVKANKLKLQDPRELNEVFQKEDTSLEEELTKILLK