Basic Information | |
---|---|
Taxon OID | 2199352025 Open in IMG/M |
Scaffold ID | deepsgr__Contig_33848 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Argonne National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 517 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rothamsted, Uk, For Project Deep Soil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | United Kingdom Rothamsted | |||||||
Coordinates | Lat. (o) | 56.03 | Long. (o) | -2.82 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041871 | Metagenome / Metatranscriptome | 159 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
deepsgr_00199380 | F041871 | N/A | MRYAETAVAKLLFTCPNTNRKAPTGVEMDVQGLRAQWKARLKLDCPYCSDVHDICVREVYINGALDNLDQLRRA |
⦗Top⦘ |