Scaffold QLA_contig04145.4145

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold QLA_contig04145.4145

Scaffold QLA_contig04145.4145

Overview

Basic Information
Taxon OID	2199352018 Open in IMG/M
Scaffold ID	QLA_contig04145.4145 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11630
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1664
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake

Source Dataset Sampling Location
Location Name	Qinghai Lake, Tibetan Plateau
Coordinates	Lat. (^o)	36.381	Long. (^o)	100.218	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058440	Metagenome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
QLA_00183390	F058440	AGGAG	XXXXXXXXXVQFEIGTLFWTPQTEQEYKSFIERYNGSEKALVALSGQIAMNYILNKINKEFEVYPKQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.