Scaffold 2200344274

Overview

Basic Information

• Taxon OID: 2199352009
• Scaffold ID: 2200344274
• Source Dataset Name: Marine subseafloor sediment microbial communities, sample from White Oak River Estuary, NC, USA 14E
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1253
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Peru Margin, Gulf Of Mexico And South Pacific Gyre

Source Dataset Sampling Location

• Location Name: White Oak River Estuary, North Carolina, subseafloor sediments from , Sample 14E; 24 centimeters below seafloor
• Coordinates
  • Lat. (^o): 34.690251
  • Long. (^o): -77.106571
  • Depth (m): .24

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059606	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
2200737535	F059606	GAG	MKTEHAFALIALILGIVGGVLLCKGAIDLASKLFEGSRHISIESPLLIVIGVVAIIASAMLWTGRYLAGGVTNIILGIITVFYGKDAEGLMILISGVLGIVAPKIKD