Scaffold GS313G0146KB_1112076023876

Overview

Basic Information

• Taxon OID: 2189573028
• Scaffold ID: GS313G0146KB_1112076023876
• Source Dataset Name: Estuarine microbial communities from Columbia River, sample from South Channel ETM site, CMGS313-FOS-0p8-ETM-15m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 924
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Columbia River estuary, South channel near Astoria
• Coordinates
  • Lat. (^o): 46.249
  • Long. (^o): -123.986
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060423	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
GS313G0146KB_00377500	F060423	N/A	MNPYSVAQETLGMSSMQRGLGGMTSPVRPGPNAYDQGGASKPSVNTQPFNNQRLAEQNTLQNVGSAAPQAGANAQGQVRSQVAQQSDAESKAQQFAATRMAEALYANDSGSAMMRLNSVLQSPEKGKFMNDIAVGKAMSAGMSPDLGQEVAQKNMYG