NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold G1P06HT01BD0ZM

Scaffold G1P06HT01BD0ZM


Overview

Basic Information
Taxon OID2170459016 Open in IMG/M
Scaffold IDG1P06HT01BD0ZM Open in IMG/M
Source Dataset NameLitter degradation ZMR2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)606
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location
Location NameUniversity of Illinois Energy Farm
CoordinatesLat. (o)40.1097Long. (o)-88.2041Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F021376Metagenome / Metatranscriptome219Y
F033892Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
2ZMR_01138350F021376AGGVYVKHLTSLQFLTYMAFFAVVIAAIFKFMPGKAPPVRTEPYPDEELGAHDRKTAKYFVAGGFFLVLGSLHMVV
2ZMR_01138360F000280GGAGMAAQDPLEPQRPARPLVGYRDVGEDVRHSRGSLYRAWIILAVLVAFYLGWTLIVFFLEPGLR
2ZMR_01138370F033892GGAVTTWDTPEQLEAYLERGYTFDRMLIDVSEVIAEPTVVVEKIF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.