NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GIO7OMY01DDM4H

Scaffold GIO7OMY01DDM4H


Overview

Basic Information
Taxon OID2170459010 Open in IMG/M
Scaffold IDGIO7OMY01DDM4H Open in IMG/M
Source Dataset NameGrass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)525
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location NameRothamsted, Harpenden, UK
CoordinatesLat. (o)51.804241Long. (o)-0.372114Alt. (m)Depth (m)0 to .09
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039784Metagenome / Metatranscriptome163Y

Sequences

Protein IDFamilyRBSSequence
F62_00354070F039784AGGAMKLPPDIEFHEDIRLLIYRPKGVINEAEINRVIGVIEGIEAASQHPFNRIF*YVGNHEVELNFHYVIQASLHRRLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.