Basic Information | |
---|---|
Taxon OID | 2170459009 Open in IMG/M |
Scaffold ID | GA8DASG02G8I0Q Open in IMG/M |
Source Dataset Name | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 533 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rothamsted, Harpenden, UK | |||||||
Coordinates | Lat. (o) | 51.804241 | Long. (o) | -0.372114 | Alt. (m) | Depth (m) | 0 to .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F085975 | Metagenome | 111 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
F47_04128320 | F085975 | AGG | VQSSKDIPGVLDGEKVNLGRSAEINFVSKAVTVLVPASS |
⦗Top⦘ |