Basic Information | |
---|---|
Taxon OID | 2166559019 Open in IMG/M |
Scaffold ID | stn_contig02957 Open in IMG/M |
Source Dataset Name | Stentor MTG 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Leibniz Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 795 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus → Stentor Amethystinus Microbial Communities From Lake Stechlin, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Stechlin Germany | |||||||
Coordinates | Lat. (o) | 53.144075 | Long. (o) | 13.02274 | Alt. (m) | Depth (m) | 68 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006744 | Metagenome / Metatranscriptome | 365 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
stn_00419750 | F006744 | AGAAGG | MNLDEFRAHVEATRQASKAEALSVLSATITKSTTKEGN |
⦗Top⦘ |