Scaffold JCVI_READ_953816

Overview

Basic Information

• Taxon OID: 2166559017
• Scaffold ID: JCVI_READ_953816
• Source Dataset Name: Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 965
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026579	Metagenome / Metatranscriptome	197	N

Sequences

Protein ID	Family	RBS	Sequence
Ocean5-_01452860	F026579	N/A	MKQLVLLIKETKMRINLIVLILALMALSVTQPSFSETTSEVKIIFADKEGEGKPTDDEEPDCE