Scaffold SwRhRL2b_contig_2012832

Overview

Basic Information

• Taxon OID: 2162886007
• Scaffold ID: SwRhRL2b_contig_2012832
• Source Dataset Name: Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 860
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location

• Location Name: East Lansing, MI
• Coordinates
  • Lat. (^o): 42.794771
  • Long. (^o): -84.393804

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018801	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
SwRhRL2b_0389.00002100	F018801	AGGA	MGLTILSIPFIALGVFLKPYALENSRCIGFAGLGPYCFEQASSMPEVIKYGSVAVGFAFLYGGRLQIKRRRNGR