Basic Information | |
---|---|
Taxon OID | 2149837016 Open in IMG/M |
Scaffold ID | STU__NODE_6035_len_7745_cov_12_298128 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from the University of Arizona (HMP) - Ef2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chinese National Human Genome Center, Beijing |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7773 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bording, Denmark | |||||||
Coordinates | Lat. (o) | 56.13 | Long. (o) | 9.24 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098313 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
STU_0991.00000180 | F098313 | N/A | VNLINKINNFSNVREKKFDFVIYPLDLIITVGLDYKTLCDRFENMEPEHEGKWGDEDDMDKEASFANLVRDRDDDDKFAILWNFSSDDDLIMRNICHESFHIAMSVCQFCNMSLGFKVGEDEHAAYIAGFAGDCVSEFINSKNTD |
⦗Top⦘ |