Scaffold LBLPo__contig00031

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LBLPo__contig00031

Scaffold LBLPo__contig00031

Overview

Basic Information
Taxon OID	2149837011 Open in IMG/M
Scaffold ID	LBLPo__contig00031 Open in IMG/M
Source Dataset Name	Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from post-bloom
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	787
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa

Source Dataset Sampling Location
Location Name	LaBonte Lake, Laramie, Wyoming
Coordinates	Lat. (^o)	41.321	Long. (^o)	-105.586	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040944	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
LBLPo_00324290	F040944	N/A	MESMVHTENEKLFPSGGLSIPYEVGHGITLASLIDSRDYLQSELDQWTDNPKDEMNPDGYWLHPEDVVNNMKLVRAMNLLIEYYGG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.