Scaffold NODE_7114_length_1308_cov_11.392201

Overview

Basic Information

• Taxon OID: 2140918013
• Scaffold ID: NODE_7114_length_1308_cov_11.392201
• Source Dataset Name: Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1340
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Giovannonibacteria → Candidatus Giovannonibacteria bacterium GW2011_GWA2_53_7 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Iowa, USA
• Coordinates
  • Lat. (^o): 41.827222
  • Long. (^o): -93.008611

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052446	Metagenome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Iowa-Corn-GraphCirc_00405850	F052446	GGAGG	MEMLQELNEDAVLQLQQMLNTPIEDQAALYELNLLSSLLDNGVHLLGNAESDEETCEILRQVIKSAFVIGRRHINQLV