NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ConsensusfromContig36204

Scaffold ConsensusfromContig36204


Overview

Basic Information
Taxon OID2140918006 Open in IMG/M
Scaffold IDConsensusfromContig36204 Open in IMG/M
Source Dataset NamePermafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6269
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location NameBonanza creek, Alaska, USA
CoordinatesLat. (o)64.7Long. (o)-148.3Alt. (m)Depth (m).3 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018061Metagenome / Metatranscriptome237Y

Sequences

Protein IDFamilyRBSSequence
P1_C_00249140F018061N/AKLGKNQREVRVWYSGFGNPQYLVVIRQTPNSTTGQLLFWWDQYYETTPASADVRVDNFVRAGYDCGPIAKRDSRYGEDRWISSVCEAKLKGTPDWKAFLSEVAGHPLPDNPAAVDSAPEDTTGSETWGITVEMKSGTNYALTHYRIALTFGTPEPGRGPKLQDMIHALAATAKRQTSVAQGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.