Basic Information | |
---|---|
Taxon OID | 2140918006 Open in IMG/M |
Scaffold ID | ConsensusfromContig110089 Open in IMG/M |
Source Dataset Name | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 694 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bonanza creek, Alaska, USA | |||||||
Coordinates | Lat. (o) | 64.7 | Long. (o) | -148.3 | Alt. (m) | Depth (m) | .3 to .7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038001 | Metagenome / Metatranscriptome | 167 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
P1_C_01841860 | F038001 | GGAG | VRTLSSFLRREVVTESGRSLGRCYDLRGELSPTTLRVTGLCIGRRALLEHLGIRAQKPQAIVPWEAIVRIEGKRIIVHDDAPAP |
⦗Top⦘ |