Scaffold contig00976

Overview

Basic Information

• Taxon OID: 2140918005
• Scaffold ID: contig00976
• Source Dataset Name: Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 820
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates
  • Lat. (^o): 74.0678
  • Long. (^o): -145.54687
  • Depth (m): 3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095487	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
ASHM485C_06567300	F095487	AGGA	MQLDKKFTPANVITVVLTVAFALMAWQDVKGQVEVNSSSIHKGQVVAEEMRDNVHTLKVDVALLKQDSINAAASRDEIKANQAEILKLLRNK