NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KansclcFeb2_ConsensusfromContig119874

Scaffold KansclcFeb2_ConsensusfromContig119874


Overview

Basic Information
Taxon OID2124908045 Open in IMG/M
Scaffold IDKansclcFeb2_ConsensusfromContig119874 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)546
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameKansas, USA
CoordinatesLat. (o)39.1049Long. (o)-96.6054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064584Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
KansclcFeb2_14625800F064584N/AMCTVPESTTDEKKMKRLTIMLCALIGHPSYAHAAPALKLEDIKQIVCESTVTYDKDSPNEKTAARGVKMFKPGSRKDVKRRPGAFLLAEVDPDSDEQDAGYDQQFYFSPIKGGKLSFRFIADWKAHGELKLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.