Scaffold A2_c1_ConsensusfromContig18773

Overview

Basic Information

• Taxon OID: 2124908043
• Scaffold ID: A2_c1_ConsensusfromContig18773
• Source Dataset Name: Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 959
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas translucens (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026917	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
A2_c1_00999110	F026917	N/A	GSKSQSLYLMAIHNTEVKAMSKGNGAEDHIRAKVRMVVIDESLFGVLSCGERIAVALVLNRPDLVKWWGTMLEAVDRLDPEWTQAALRVQRDGWEEQL