NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B4_c_ConsensusfromContig48171

Scaffold B4_c_ConsensusfromContig48171


Overview

Basic Information
Taxon OID2124908040 Open in IMG/M
Scaffold IDB4_c_ConsensusfromContig48171 Open in IMG/M
Source Dataset NameSoil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)707
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location NameBonanza creek, Alaska, USA
CoordinatesLat. (o)64.7Long. (o)-148.3Alt. (m)Depth (m).3 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086687Metagenome110Y

Sequences

Protein IDFamilyRBSSequence
B4_c_00482040F086687N/AVLTDSTKSETRIDINCLTEPEKKLFEKVEEITKKYSPASPPQNVIEXNAXLWNKGLXXFGRRATELFVEIXPASXCCDELEEWYFKLYFHNFMLDWXESVQEXXKMPKEXHDALLCERREMGMLKAVFRLPRNKQQTLKTETEEEPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.