NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MBSR2a_Contig_4342

Scaffold MBSR2a_Contig_4342


Overview

Basic Information
Taxon OID2124908025 Open in IMG/M
Scaffold IDMBSR2a_Contig_4342 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample from Bulk Soil Replicate 2: eDNA_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)669
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan State University
CoordinatesLat. (o)42.406189Long. (o)-85.40016Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007754Metagenome / Metatranscriptome345Y

Sequences

Protein IDFamilyRBSSequence
MBSR2a_00063740F007754N/AAVFATPASAQVVLGGQTWTNTGTTLSLDAVVPGGNQPLNIQCVICGDNQPQQQADFGYTNFKNSGNLSDAIFFSTNVAGGANPGVDTVGIGYDGSFLRNYLIATGDTNLQFSIGIDVNDTGTPQTLEAFALLNLTQHTVLAQYSLLQPGGTLIPSANNGTGFPDYTLSGFNIQLGTDIQAGDQLIFYARISGANDGPDSFFLIPQQVPVPTIGAGLPALFAFG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.