Scaffold SwRhBV22_Contig_3712

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SwRhBV22_Contig_3712

Scaffold SwRhBV22_Contig_3712

Overview

Basic Information
Taxon OID	2124908018 Open in IMG/M
Scaffold ID	SwRhBV22_Contig_3712 Open in IMG/M
Source Dataset Name	Switchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	520
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location Name	Central Sands area of central Wisconsin.
Coordinates	Lat. (^o)	44.166906	Long. (^o)	-89.649965	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062946	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
SwRhBV22_00120980	F062946	N/A	LASAAEGDSAVQGTPPQGAPSTPGIDRHELCKIQVWRWSMQNRTYEPTGEDLEIQRLRGSRINFAWSNESDRLVIVNARGTNEAECAFFQVGGTFLELVDRSRRLNEMKIVALAFATYHSGIAAVSVDSDTPALRNVKLFSFSGDYLEVIPVSGKDSIRLSEGFLPNGIGFGP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.