NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SwRhBV22_Contig_3712

Scaffold SwRhBV22_Contig_3712


Overview

Basic Information
Taxon OID2124908018 Open in IMG/M
Scaffold IDSwRhBV22_Contig_3712 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)520
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameCentral Sands area of central Wisconsin.
CoordinatesLat. (o)44.166906Long. (o)-89.649965Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062946Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
SwRhBV22_00120980F062946N/ALASAAEGDSAVQGTPPQGAPSTPGIDRHELCKIQVWRWSMQNRTYEPTGEDLEIQRLRGSRINFAWSNESDRLVIVNARGTNEAECAFFQVGGTFLELVDRSRRLNEMKIVALAFATYHSGIAAVSVDSDTPALRNVKLFSFSGDYLEVIPVSGKDSIRLSEGFLPNGIGFGP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.