Scaffold SwRhBV22_Contig_3123

Overview

Basic Information

• Taxon OID: 2124908018
• Scaffold ID: SwRhBV22_Contig_3123
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 625
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location

• Location Name: Central Sands area of central Wisconsin.
• Coordinates
  • Lat. (^o): 44.166906
  • Long. (^o): -89.649965

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003244	Metagenome / Metatranscriptome	498	Y

Sequences

Protein ID	Family	RBS	Sequence
SwRhBV22_00004390	F003244	GAGG	VKWKNRGDPKGKLGDERVRTKFAWFPVEADDGFTYWLAPVVVREQLLPKVTRGGFEDDEQTWHVVEA