Basic Information | |
---|---|
Taxon OID | 2124908018 Open in IMG/M |
Scaffold ID | SwRhBV22_Contig_2905 Open in IMG/M |
Source Dataset Name | Switchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1685 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium RBG_16_71_46 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Central Sands area of central Wisconsin. | |||||||
Coordinates | Lat. (o) | 44.166906 | Long. (o) | -89.649965 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026351 | Metagenome / Metatranscriptome | 198 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SwRhBV22_00158050 | F026351 | GAGG | MKIKIAVMMCAALGLPGVIFGQHHAPPATPTAEQSITGDWVIHFQAGHESVSGSLHLQADGERLAGTVETGHTGPGTVENGKWSKQKLEATLVFKKHESVVLEGELKSNGTLAGNYTTEGRTETWQAERKSARL |
⦗Top⦘ |