Basic Information | |
---|---|
Taxon OID | 2124908016 Open in IMG/M |
Scaffold ID | OU_3_2171_1 Open in IMG/M |
Source Dataset Name | Sample 642 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Los Alamos National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4828 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → → Environmental Microbial Communities From Lanl |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013464 | Metagenome | 271 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
OU_01891780 | F013464 | AGG | MNKGQQVWIRVRGAPDDPESFDLATWNGIVWQIPRTNSLGDVIYIQIPDYMVSETMPATTNPQDLYRKLKEEREPKP |
⦗Top⦘ |