Scaffold pt300_5755772

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold pt300_5755772

Scaffold pt300_5755772

Overview

Basic Information
Taxon OID	2124908014 Open in IMG/M
Scaffold ID	pt300_5755772 Open in IMG/M
Source Dataset Name	Human Palatine Tonsils microbiome from visit number 1 of subject 763496533
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Los Alamos National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4815
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Palatine Tonsil → Human Palatine Tonsil Microbial Communities From Los Alamos National Lab, Usa

Source Dataset Sampling Location
Location Name	St. Louis, MO
Coordinates	Lat. (^o)	38.646	Long. (^o)	-90.224	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084362	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
pt300_01256160	F084362	N/A	MNCTFTVRWSDEKNEPHAKTYATEDSAKRAKKWLLEHGVRSVDIAVKINNKPAGSLEDGDKPSETEAEQKGFWWEK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.