Scaffold kg300_2254205

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold kg300_2254205

Scaffold kg300_2254205

Overview

Basic Information
Taxon OID	2124908010 Open in IMG/M
Scaffold ID	kg300_2254205 Open in IMG/M
Source Dataset Name	Keratinized_gingiva_contig300
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Los Alamos National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2236
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Keratinized Gingiva → Keratinized Gingiva Microbial Communities From Saint Louis, Missouri, Usa

Source Dataset Sampling Location
Location Name	St. Louis, MO
Coordinates	Lat. (^o)	38.646	Long. (^o)	-90.224	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089056	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
kg300_01145080	F089056	N/A	SKRKEADNTMVLEKNHAFFLWNNDSLGCKHERTIEMGEELYNTFKKSNKNDSILLKEYLGTPTRRFKDKEVIIFMYYINSCCDNGQLLEECDVSFISITFTNKNKILFGKGIQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.