Scaffold FWIRA_GRAM18401DV5QC

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FWIRA_GRAM18401DV5QC

Scaffold FWIRA_GRAM18401DV5QC

Overview

Basic Information
Taxon OID	2124908009 Open in IMG/M
Scaffold ID	FWIRA_GRAM18401DV5QC Open in IMG/M
Source Dataset Name	Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	516
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location Name	Wisconsin Rhinelander (WIR)
Coordinates	Lat. (^o)	45.68	Long. (^o)	-89.63	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053399	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
FWIRA_01886560	F053399	N/A	MGLEPSDVLFIVIVIWIALEIINGDWGGGHRGRVPVQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.