Scaffold FNTS010_GJ857YP01C08HX

Overview

Basic Information

• Taxon OID: 2119805011
• Scaffold ID: FNTS010_GJ857YP01C08HX
• Source Dataset Name: Soil microbial communities from sample at Multiple FACE and OTC sites
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 507
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location

• Location Name: USA: Sugar bunker, Nevada
• Coordinates
  • Lat. (^o): 36.766667
  • Long. (^o): -115.95

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042199	Metagenome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
FNTS010_07784780	F042199	AGAAGG	LERIGEDYPEEEMLFRDLWEDETQKDVVVDCLKADCEVRTGRPPGY