Scaffold FNTS007_GKN1E7E02JAXIZ

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FNTS007_GKN1E7E02JAXIZ

Scaffold FNTS007_GKN1E7E02JAXIZ

Overview

Basic Information
Taxon OID	2119805009 Open in IMG/M
Scaffold ID	FNTS007_GKN1E7E02JAXIZ Open in IMG/M
Source Dataset Name	Soil microbial communities from sample at FACE Site NTS_007 Nevada Test Site
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	513
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location Name	Nevada Test Site FACE
Coordinates	Lat. (^o)	36.766667	Long. (^o)	-115.95	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070770	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
FNTS007_09614430	F070770	GGAGG	MAKKRAGGQSAPEAWIGRQVVLGIGTQGARLSGELKEVSDRGXVLHYGTETGREPGHVFYPWSNVQANPTP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.