NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BSEYNP_contig06978__length_988___numreads_6

Scaffold BSEYNP_contig06978__length_988___numreads_6


Overview

Basic Information
Taxon OID2100351008 Open in IMG/M
Scaffold IDBSEYNP_contig06978__length_988___numreads_6 Open in IMG/M
Source Dataset NameHot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_E
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)988
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameNorris Geyser Basin, Yellowstone National Park
CoordinatesLat. (o)44.733Long. (o)-110.708917Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027904Metagenome / Metatranscriptome193N
F067921Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
BSEYNP_01375750F067921N/AQGTKHNFTTLYYNFATEVSNFLPMAPFGGQASSTTSPPYITNFKFSLQLVQNVTDMFDLSRNYDAYQVFYGIAPSYLRTMLQIQQQFIAVLEQNINPSQSFVEMGIDGFQSPLFAPDPRTEFIVFSNLTYNMTLMNTATIPIMPAFNFVINRMTLEPLSKQEIKKAILAGFPVRTLGAVDSAIPVSRDNYPGLQTVTYKEVYGGGS
BSEYNP_01375760F027904GGAGGVECKYDPPTYDLFNLNNGSTLVGQSPVTLLYEGQPNAAVYAPPDLTLRAKQIIIQNATTSPITVQLLAVAAPNTSLPGPIPKTPPIPVNAGSAVTLSEEEWGIAVRSGYG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.