NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LWFCAnN_GO09JKT02F00ZJ

Scaffold LWFCAnN_GO09JKT02F00ZJ


Overview

Basic Information
Taxon OID2088090007 Open in IMG/M
Scaffold IDLWFCAnN_GO09JKT02F00ZJ Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - from flow sorted anaerobic plus nitrate
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)536
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location NameLake Washington, Seattle, Washington, USA
CoordinatesLat. (o)47.63Long. (o)-122.27889Alt. (m)Depth (m)62
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049443Metagenome146Y

Sequences

Protein IDFamilyRBSSequence
LWFCAnN_08481020F049443N/AVNPLAAVKPVVVFNTNVVPVGGLTKLIDASKVAVELNPFNTNPLASCPAVDCRNDLESGADTLCPNPKNDVNKNNVTNICFILFNY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.