NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ASA129_GJG7ZZE02GM8QF

Scaffold ASA129_GJG7ZZE02GM8QF


Overview

Basic Information
Taxon OID2084038021 Open in IMG/M
Scaffold IDASA129_GJG7ZZE02GM8QF Open in IMG/M
Source Dataset NameMarine sediment archaeal communities from Santa Barbara Basin, CA, that are methane-oxidizing, sample 9-12 cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)528
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Santa Barbara Basin, Ca, That Are Anaerobic And Methane-Oxidizing

Source Dataset Sampling Location
Location NameSanta Barbara Basin
CoordinatesLat. (o)34.21Long. (o)-119.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036102Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
ASA129_01050640F036102AGGAGGMDEQKMKELFRATANVQTPEGLAAYQAFAAALTIPILEKIELESIMRQLFTVEPLEPGAQASYPVAEDFEIPVWVLPGLGYIAQNFIEGIGEDVVVPTFT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.