Scaffold ADL5mRS1u_GM034OG02HEWG5

Overview

Basic Information

• Taxon OID: 2084038019
• Scaffold ID: ADL5mRS1u_GM034OG02HEWG5
• Source Dataset Name: Hypersaline microbial communities from Antarctic Deep Lake - 5mRS 0.1um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → Halomonas subterranea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Antarctic Deep Lake

Source Dataset Sampling Location

• Location Name: Deep Lake Antarctica
• Coordinates
  • Lat. (^o): -68.54
  • Long. (^o): 78.18
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056197	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
ADL5mRS1u_00425570	F056197	GGAG	MDNFYKSESGELFVNPIVANHAGLTEITQEQFNQIIADRNKLTTDQLLQRLTQARKDQERQGVTINGIRYAGDPGNRQALREAIAFMND