Scaffold FNTS_contig07820

Overview

Basic Information

• Taxon OID: 2081372006
• Scaffold ID: FNTS_contig07820
• Source Dataset Name: Soil microbial communities from sample at FACE Site NTS_071 Nevada Test Site
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 525
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location

• Location Name: Nevada Test Site
• Coordinates
  • Lat. (^o): 36.766667
  • Long. (^o): -115.95

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002654	Metagenome / Metatranscriptome	539	Y

Sequences

Protein ID	Family	RBS	Sequence
FNTS_04916890	F002654	AGG	VLNYQTFNDKVVCQKGNSPEQVFKVPKFLLSESKEVFKLYNQEIGLEAAIF