NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BRPC3_contig02345

Scaffold BRPC3_contig02345


Overview

Basic Information
Taxon OID2077657009 Open in IMG/M
Scaffold IDBRPC3_contig02345 Open in IMG/M
Source Dataset NameBovine rumen viral communities from University of Illinois Dairy Farm in Urbana, IL, Cow rumen 6993
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)572
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Viral Communities From University Of Illinois Dairy Farm In Urbana, Il

Source Dataset Sampling Location
Location NameUniversity of Illinois Dairy Farm in Urbana, IL
CoordinatesLat. (o)40.0886Long. (o)-88.2202Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100165Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
BRPC3_00340260F100165N/AMKVAIYSIHSDYKKLSTDFEKLKNIVTECLQNDTFDGHGTEIFDLVMDIDYHLDRIYVPLNDTYNDVFIRSKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.